2.92 Rating by CuteStat

digitalroadrage.com is 2 months 3 weeks old. It is a domain having .com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, digitalroadrage.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

digitalroadrage.com - Registered at Namecheap.com

Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 2 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

glures.com - Registered at Namecheap.com

- glures.com

  Not Applicable   $ 8.95

chibipanda.net - Registered at Namecheap.com

- chibipanda.net

  Not Applicable   $ 8.95

warnersariintakesystems.review - Registered at Namecheap.com

- warnersariintakesystems.review

  Not Applicable   $ 8.95

feedbirdcamiva.men - Registered at Namecheap.com

- feedbirdcamiva.men

  Not Applicable   $ 8.95

crowdvengence.com - Registered at Namecheap.com

- crowdvengence.com

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 17 Sep 2017 03:52:19 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 4918
Connection: keep-alive
Keep-Alive: timeout=15
Cache-Control: no-cache
Pragma: no-cache
Expires: -1

Domain Information

Domain Registrar: NAMECHEAP INC.
Registration Date: 2017-09-15 2 months 3 weeks 4 days ago
Last Modified: 2017-09-15 2 months 3 weeks 4 days ago
Domain Status:

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com United States United States
dns2.registrar-servers.com United States United States

DNS Record Analysis

Host Type TTL Extra
digitalroadrage.com A 1796 IP:
digitalroadrage.com NS 1799 Target: dns2.registrar-servers.com
digitalroadrage.com NS 1799 Target: dns1.registrar-servers.com
digitalroadrage.com SOA 3600 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 2017091501
Refresh: 43200
Retry: 3600
Expire: 604800
digitalroadrage.com MX 1799 Priority: 10
Target: eforward1.registrar-servers.com
digitalroadrage.com MX 1799 Priority: 10
Target: eforward3.registrar-servers.com
digitalroadrage.com MX 1799 Priority: 20
Target: eforward5.registrar-servers.com
digitalroadrage.com MX 1799 Priority: 15
Target: eforward4.registrar-servers.com
digitalroadrage.com MX 1799 Priority: 10
Target: eforward2.registrar-servers.com
digitalroadrage.com TXT 1799 TXT: v=spf1

Similarly Ranked Websites

Discover - Google+

- plus.google.com

Discover amazing things and connect with passionate people.

  1   $ 8,833,062,960.00

Google Drive - Cloud Storage & File Backup for Photos, Docs & More

- drive.google.com

Get access to files anywhere through secure cloud storage and file backup for your photos, videos, files and more with Google Drive.

  1   $ 8,833,062,960.00

Google Translate

- translate.google.com

  1   $ 8,833,062,960.00

Google News

- news.google.com

  1   $ 8,833,062,960.00


- ipv4.google.com

  1   $ 8,833,062,960.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Registry Domain ID: 2163138136_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-09-15T12:23:52Z
Creation Date: 2017-09-15T12:23:50Z
Registry Expiry Date: 2018-09-15T12:23:50Z
Registrar: NameCheap Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-17T03:52:11Z

Comments / Ratings / Reviews / Feedbacks for digitalroadrage.com